| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (57 PDB entries) |
| Domain d5b0yf_: 5b0y F: [312551] Other proteins in same PDB: d5b0yc_, d5b0yd_, d5b0yg_, d5b0yh_ automated match to d1kx5b_ complexed with cl, mn |
PDB Entry: 5b0y (more details), 2.56 Å
SCOPe Domain Sequences for d5b0yf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b0yf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtlygfgg
Timeline for d5b0yf_: