Lineage for d5aeua2 (5aeu A:180-459)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192501Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2192753Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2193064Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2193065Protein automated matches [190218] (22 species)
    not a true protein
  7. 2193068Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2269182Domain d5aeua2: 5aeu A:180-459 [312488]
    Other proteins in same PDB: d5aeua1, d5aeub_, d5aeuc1, d5aeud_, d5aeue1, d5aeuf_, d5aeug1, d5aeuh_
    automated match to d2xr8a2

Details for d5aeua2

PDB Entry: 5aeu (more details), 2.49 Å

PDB Description: crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d5aeua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aeua2 d.129.3.0 (A:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d5aeua2:

Click to download the PDB-style file with coordinates for d5aeua2.
(The format of our PDB-style files is described here.)

Timeline for d5aeua2:

  • d5aeua2 appears in periodic updates to SCOPe 2.06 starting on 2016-04-12