SCOPe 2.08: Domain d5aeug1: 5aeu G:18-179

Lineage for d5aeug1 (5aeu G:18-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)

8. Domain d5aeug1: 5aeu G:18-179 [313502]
   Other proteins in same PDB: d5aeua2, d5aeub_, d5aeuc2, d5aeud_, d5aeue2, d5aeuf_, d5aeug2, d5aeuh_
   automated match to d2yfia1
   complexed with fe2, fes

Details for d5aeug1

PDB Entry: 5aeu, 2.49 Å

PDB Description: crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400

PDB Compounds: (G:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d5aeug1:

Sequence, based on SEQRES records:

>d5aeug1 b.33.1.0 (G:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records):

>d5aeug1 b.33.1.0 (G:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

Timeline for d5aeug1:

• d5aeug1 first appeared in SCOPe 2.06
  
• d5aeug1 appears in SCOPe 2.07