PDB entry 5aeu

View 5aeu on RCSB PDB site
Description: Crystal structure of II9 variant of Biphenyl dioxygenase from Burkholderia xenovorans LB400
Class: oxidoreductase
Keywords: oxidoreductase, bphae-ii9, biphenyl, polychlorinated biphenyls
Deposited on 2015-01-10, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aeua1, d5aeua2
  • Chain 'B':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aeub_
  • Chain 'C':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aeuc1, d5aeuc2
  • Chain 'D':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aeud_
  • Chain 'E':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aeue1, d5aeue2
  • Chain 'F':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aeuf_
  • Chain 'G':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aeug1, d5aeug2
  • Chain 'H':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aeuh_
  • Heterogens: FES, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aeuA (A:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeuA (A:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aeuB (B:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeuB (B:)
    phffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrm
    iregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatp
    dtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnls
    mff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5aeuC (C:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeuC (C:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5aeuD (D:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeuD (D:)
    hffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmi
    regeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpd
    tfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsm
    ff
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5aeuE (E:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeuE (E:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5aeuF (F:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeuF (F:)
    hffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmi
    regeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpd
    tfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsm
    ff
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5aeuG (G:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeuG (G:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5aeuH (H:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeuH (H:)
    hffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmi
    regeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpd
    tfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsm
    ff