Lineage for d4zlbb1 (4zlb B:1-132)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401897Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2401898Protein automated matches [226913] (9 species)
    not a true protein
  7. 2401899Species Bitter gourd (Momordica charantia) [TaxId:3673] [312303] (9 PDB entries)
  8. 2401916Domain d4zlbb1: 4zlb B:1-132 [312388]
    Other proteins in same PDB: d4zlba_
    automated match to d4hr6c1
    complexed with bma, fuc, lat, nag, xyp

Details for d4zlbb1

PDB Entry: 4zlb (more details), 2.55 Å

PDB Description: structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with lactose
PDB Compounds: (B:) rRNA N-glycosidase

SCOPe Domain Sequences for d4zlbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zlbb1 b.42.2.0 (B:1-132) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
neqcspqqrttrisgrdglcvdvygaltadgsrvilypcgqqqnqqwtfypdntirslgk
clatsalssgsnvvitncdylryddgwmvsssgtmmnksshlvltanaatsrtnltgenn
vfaakqawrign

SCOPe Domain Coordinates for d4zlbb1:

Click to download the PDB-style file with coordinates for d4zlbb1.
(The format of our PDB-style files is described here.)

Timeline for d4zlbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zlbb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4zlba_