SCOPe 2.07: Domain d4zbvb1: 4zbv B:1-132

Lineage for d4zbvb1 (4zbv B:1-132)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [312303] (9 PDB entries)

8. Domain d4zbvb1: 4zbv B:1-132 [312324]
   Other proteins in same PDB: d4zbva_
   automated match to d4hr6c1
   complexed with a2g, bma, edo, fuc, gal, mbn, nag, pge, po4

Details for d4zbvb1

PDB Entry: 4zbv, 2 Å

PDB Description: structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with benzyl t-antigen

PDB Compounds: (B:) rRNA N-glycosidase

SCOPe Domain Sequences for d4zbvb1:

Sequence; same for both SEQRES and ATOM records:

>d4zbvb1 b.42.2.0 (B:1-132) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
neqcspqqrttrisgrdglcvdvygaltadgsrvilypcgqqqnqqwtfypdntirslgk
clatsalssgsnvvitncdylryddgwmvsssgtmmnksshlvltanaatsrtnltgenn
vfaakqawrign

Timeline for d4zbvb1:

• d4zbvb1 first appeared in SCOPe 2.06
  
• d4zbvb1 appears in the current release, SCOPe 2.08