Lineage for d1bvyf_ (1bvy F:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158545Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1158546Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1158631Protein FMN-binding domain of the cytochrome P450bm-3 [52227] (1 species)
  7. 1158632Species Bacillus megaterium [TaxId:1404] [52228] (1 PDB entry)
  8. 1158633Domain d1bvyf_: 1bvy F: [31207]
    Other proteins in same PDB: d1bvya_, d1bvyb_
    complexed with edo, fmn, hem

Details for d1bvyf_

PDB Entry: 1bvy (more details), 2.03 Å

PDB Description: complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)
PDB Compounds: (F:) protein (cytochrome p450 bm-3)

SCOPe Domain Sequences for d1bvyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]}
ntpllvlygsnmgtaegtardladiamskgfapqvatldshagnlpregavlivtasyng
hppdnakqfvdwldqasadevkgvrysvfgcgdknwattyqkvpafidetlaakgaenia
drgeadasddfegtyeewrehmwsdvaayfnl

SCOPe Domain Coordinates for d1bvyf_:

Click to download the PDB-style file with coordinates for d1bvyf_.
(The format of our PDB-style files is described here.)

Timeline for d1bvyf_: