Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
Superfamily c.23.5: Flavoproteins [52218] (3 families) |
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) |
Protein FMN-binding domain of the cytochrome P450bm-3 [52227] (1 species) |
Species Bacillus megaterium [TaxId:1404] [52228] (1 PDB entry) |
Domain d1bvyf_: 1bvy F: [31207] Other proteins in same PDB: d1bvya_, d1bvyb_ |
PDB Entry: 1bvy (more details), 2.03 Å
SCOP Domain Sequences for d1bvyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium} ntpllvlygsnmgtaegtardladiamskgfapqvatldshagnlpregavlivtasyng hppdnakqfvdwldqasadevkgvrysvfgcgdknwattyqkvpafidetlaakgaenia drgeadasddfegtyeewrehmwsdvaayfnl
Timeline for d1bvyf_: