Lineage for d1d03a_ (1d03 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2115526Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2115527Protein Flavodoxin [52220] (10 species)
  7. 2115602Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries)
  8. 2115603Domain d1d03a_: 1d03 A: [31182]
    complexed with fmn

Details for d1d03a_

PDB Entry: 1d03 (more details), 1.85 Å

PDB Description: refined structures of oxidized flavodoxin from anacystis nidulans
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1d03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d03a_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwgvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOPe Domain Coordinates for d1d03a_:

Click to download the PDB-style file with coordinates for d1d03a_.
(The format of our PDB-style files is described here.)

Timeline for d1d03a_: