SCOPe 2.08: Domain d1d03a_: 1d03 A:

Lineage for d1d03a_ (1d03 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (11 species)

7. Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries)

8. Domain d1d03a_: 1d03 A: [31182]
   complexed with fmn

Details for d1d03a_

PDB Entry: 1d03, 1.85 Å

PDB Description: refined structures of oxidized flavodoxin from anacystis nidulans

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1d03a_:

Sequence; same for both SEQRES and ATOM records:

>d1d03a_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwgvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

Timeline for d1d03a_:

• d1d03a_ first appeared (with stable ids) in SCOP 1.55
  
• d1d03a_ appears in SCOPe 2.07