![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
![]() | Protein automated matches [190569] (9 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [269237] (7 PDB entries) |
![]() | Domain d4xobc1: 4xob C:1-158 [311758] automated match to d3zl2a_ complexed with kgm, so4 |
PDB Entry: 4xob (more details), 3 Å
SCOPe Domain Sequences for d4xobc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xobc1 b.2.3.2 (C:1-158) automated matches {Escherichia coli [TaxId: 83333]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d4xobc1: