Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
Protein automated matches [190569] (9 species) not a true protein |
Species Escherichia coli [TaxId:83333] [269237] (7 PDB entries) |
Domain d4xobg2: 4xob G:159-279 [311648] automated match to d1klfb2 complexed with kgm, so4 |
PDB Entry: 4xob (more details), 3 Å
SCOPe Domain Sequences for d4xobg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xobg2 b.2.3.2 (G:159-279) automated matches {Escherichia coli [TaxId: 83333]} ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy q
Timeline for d4xobg2: