Lineage for d4xobg2 (4xob G:159-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767660Protein automated matches [190569] (9 species)
    not a true protein
  7. 2767692Species Escherichia coli [TaxId:83333] [269237] (7 PDB entries)
  8. 2767704Domain d4xobg2: 4xob G:159-279 [311648]
    automated match to d1klfb2
    complexed with kgm, so4

Details for d4xobg2

PDB Entry: 4xob (more details), 3 Å

PDB Description: crystal structure of a fimh*dsf complex from e.coli k12 with bound heptyl alpha-d-mannopyrannoside
PDB Compounds: (G:) protein fimh

SCOPe Domain Sequences for d4xobg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xobg2 b.2.3.2 (G:159-279) automated matches {Escherichia coli [TaxId: 83333]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d4xobg2:

Click to download the PDB-style file with coordinates for d4xobg2.
(The format of our PDB-style files is described here.)

Timeline for d4xobg2: