Lineage for d4xs1d_ (4xs1 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485410Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)
  7. 2485417Species Salmonella enterica [TaxId:90371] [229124] (8 PDB entries)
  8. 2485441Domain d4xs1d_: 4xs1 D: [311720]
    automated match to d4ma9b_
    complexed with cl, k, so4; mutant

Details for d4xs1d_

PDB Entry: 4xs1 (more details), 2.1 Å

PDB Description: salmonella typhimurium ahpc t43v mutant
PDB Compounds: (D:) Alkyl hydroperoxide reductase subunit C

SCOPe Domain Sequences for d4xs1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xs1d_ c.47.1.10 (D:) Alkyl hydroperoxide reductase AhpC {Salmonella enterica [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadfvfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc

SCOPe Domain Coordinates for d4xs1d_:

Click to download the PDB-style file with coordinates for d4xs1d_.
(The format of our PDB-style files is described here.)

Timeline for d4xs1d_: