Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species) |
Species Salmonella enterica [TaxId:90371] [229124] (8 PDB entries) |
Domain d4xs1d_: 4xs1 D: [311720] automated match to d4ma9b_ complexed with cl, k, so4; mutant |
PDB Entry: 4xs1 (more details), 2.1 Å
SCOPe Domain Sequences for d4xs1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xs1d_ c.47.1.10 (D:) Alkyl hydroperoxide reductase AhpC {Salmonella enterica [TaxId: 90371]} slintkikpfknqafkngefievtekdtegrwsvfffypadfvfvcptelgdvadhyeel qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc
Timeline for d4xs1d_:
View in 3D Domains from other chains: (mouse over for more information) d4xs1a_, d4xs1b_, d4xs1c_, d4xs1e_ |