SCOPe 2.07: Structural Classification of Proteins

PDB entry 4xs1

View 4xs1 on RCSB PDB site
Description: Salmonella typhimurium AhpC T43V mutant
Class: oxidoreductase
Keywords: peroxiredoxin, FF, PrxI, conformation, OXIDOREDUCTASE
Deposited on 2015-01-21, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered mutation (42)
Domains in SCOPe 2.07: d4xs1a_
Chain 'B':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered mutation (42)
Domains in SCOPe 2.07: d4xs1b_
Chain 'C':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered mutation (42)
Domains in SCOPe 2.07: d4xs1c_
Chain 'D':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered mutation (42)
Domains in SCOPe 2.07: d4xs1d_
Chain 'E':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered mutation (42)
Domains in SCOPe 2.07: d4xs1e_
Heterogens: K, CL, SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4xs1A (A:)
slintkikpfknqafkngefievtekdtegrwsvfffypadfvfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
dlvgki