SCOPe 2.03: Domain d1c7fb_: 1c7f B:

Lineage for d1c7fb_ (1c7f B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
   Uniprot P00323

8. Domain d1c7fb_: 1c7f B: [31164]
   complexed with fmn; mutant

Details for d1c7fb_

PDB Entry: 1c7f, 2 Å

PDB Description: d95e oxidized flavodoxin mutant from d. vulgaris

PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d1c7fb_:

Sequence; same for both SEQRES and ATOM records:

>d1c7fb_ c.23.5.1 (B:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1c7fb_:

• d1c7fb_ first appeared (with stable ids) in SCOP 1.55
  
• d1c7fb_ appears in SCOPe 2.02
  
• d1c7fb_ appears in SCOPe 2.04
  
• d1c7fb_ appears in the current release, SCOPe 2.08