Lineage for d1c7fa_ (1c7f A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356722Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1356723Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1356724Protein Flavodoxin [52220] (9 species)
  7. 1356760Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. 1356780Domain d1c7fa_: 1c7f A: [31163]
    complexed with fmn; mutant

Details for d1c7fa_

PDB Entry: 1c7f (more details), 2 Å

PDB Description: d95e oxidized flavodoxin mutant from d. vulgaris
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1c7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7fa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOPe Domain Coordinates for d1c7fa_:

Click to download the PDB-style file with coordinates for d1c7fa_.
(The format of our PDB-style files is described here.)

Timeline for d1c7fa_: