Lineage for d1c7fa_ (1c7f A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Desulfovibrio vulgaris [TaxId:881] [52222] (15 PDB entries) 
Domain d1c7fa_: 1c7f A: [31163]
Details for d1c7fa_
PDB Entry: 1c7f (more details), 2 Å
PDB Description: d95e oxidized flavodoxin mutant from d. vulgaris
SCOP Domain Sequences for d1c7fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7fa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai
SCOP Domain Coordinates for d1c7fa_:
Click to download the PDB-style file with coordinates for d1c7fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c7fa_:
- d1c7fa_ appears in SCOP 1.57
- d1c7fa_ appears in the current release, SCOPe 2.08
View in 3D
