Lineage for d1c7fb_ (1c7f B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. Protein Flavodoxin [52220] (11 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. Domain d1c7fb_: 1c7f B: [31164]
    complexed with fmn; mutant

Details for d1c7fb_

PDB Entry: 1c7f (more details), 2 Å

PDB Description: d95e oxidized flavodoxin mutant from d. vulgaris
PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d1c7fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7fb_ c.23.5.1 (B:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOPe Domain Coordinates for d1c7fb_ are not available.

Timeline for d1c7fb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c7fa_