SCOP 1.61: Domain d3fx2__: 3fx2 -

Lineage for d3fx2__ (3fx2 -)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.5: Flavoproteins [52218] (3 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)

6. Protein Flavodoxin [52220] (7 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries)

8. Domain d3fx2__: 3fx2 - [31160]

Details for d3fx2__

PDB Entry: 3fx2, 1.9 Å

PDB Description: comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures

SCOP Domain Sequences for d3fx2__:

Sequence; same for both SEQRES and ATOM records:

>d3fx2__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d3fx2__:

• d3fx2__ first appeared (with stable ids) in SCOP 1.55
  
• d3fx2__ appears in SCOP 1.59
  
• d3fx2__ appears in SCOP 1.63
  
• d3fx2__ appears in the current release, SCOPe 2.08, called d3fx2a_