Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) |
Superfamily c.23.5: Flavoproteins [52218] (3 families) |
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) |
Protein Flavodoxin [52220] (7 species) |
Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries) |
Domain d3fx2__: 3fx2 - [31160] |
PDB Entry: 3fx2 (more details), 1.9 Å
SCOP Domain Sequences for d3fx2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fx2__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris} akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq dglridgdpraarddivgwahdvrgai
Timeline for d3fx2__: