Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311557] (3 PDB entries) |
Domain d4x57d_: 4x57 D: [311559] Other proteins in same PDB: d4x57a1, d4x57a2, d4x57c1, d4x57c2 automated match to d1se9a_ complexed with so4 |
PDB Entry: 4x57 (more details), 2.8 Å
SCOPe Domain Sequences for d4x57d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x57d_ d.15.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eeesidikfrlydgsdigpfrysaastvdflkqrvvsdwpkgktvvpkginevklissgk ilennktvgqcktpfgdiaggvivmhvvvqps
Timeline for d4x57d_: