SCOPe 2.06: Domain d4x57d_: 4x57 D:

Lineage for d4x57d_ (4x57 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [311557] (1 PDB entry)

8. Domain d4x57d_: 4x57 D: [311559]
   Other proteins in same PDB: d4x57a1, d4x57a2, d4x57c1, d4x57c2
   automated match to d1se9a_
   complexed with so4

Details for d4x57d_

PDB Entry: 4x57, 2.8 Å

PDB Description: structure of an arabidopsis e2 / membrane-anchored ubiquitin-fold protein complex

PDB Compounds: (D:) Membrane-anchored ubiquitin-fold protein 3

SCOPe Domain Sequences for d4x57d_:

Sequence; same for both SEQRES and ATOM records:

>d4x57d_ d.15.1.0 (D:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
eeesidikfrlydgsdigpfrysaastvdflkqrvvsdwpkgktvvpkginevklissgk
ilennktvgqcktpfgdiaggvivmhvvvqps

Timeline for d4x57d_:

• d4x57d_ is new in SCOPe 2.06-stable
  
• d4x57d_ appears in SCOPe 2.07
  
• d4x57d_ appears in the current release, SCOPe 2.08