Lineage for d4x57d_ (4x57 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540703Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311557] (2 PDB entries)
  8. 2540705Domain d4x57d_: 4x57 D: [311559]
    Other proteins in same PDB: d4x57a1, d4x57a2, d4x57c1, d4x57c2
    automated match to d1se9a_
    complexed with so4

Details for d4x57d_

PDB Entry: 4x57 (more details), 2.8 Å

PDB Description: structure of an arabidopsis e2 / membrane-anchored ubiquitin-fold protein complex
PDB Compounds: (D:) Membrane-anchored ubiquitin-fold protein 3

SCOPe Domain Sequences for d4x57d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x57d_ d.15.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeesidikfrlydgsdigpfrysaastvdflkqrvvsdwpkgktvvpkginevklissgk
ilennktvgqcktpfgdiaggvivmhvvvqps

SCOPe Domain Coordinates for d4x57d_:

Click to download the PDB-style file with coordinates for d4x57d_.
(The format of our PDB-style files is described here.)

Timeline for d4x57d_: