Lineage for d2fcra_ (2fcr A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587350Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1587351Protein Flavodoxin [52220] (9 species)
  7. 1587368Species Chondrus crispus [TaxId:2769] [52221] (1 PDB entry)
  8. 1587369Domain d2fcra_: 2fcr A: [31151]
    complexed with fmn

Details for d2fcra_

PDB Entry: 2fcr (more details), 1.8 Å

PDB Description: crystal structure of oxidized flavodoxin from a red alga chondrus crispus refined at 1.8 angstroms resolution: description of the flavin mononucleotide binding site
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2fcra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]}
kigiffststgnttevadfigktlgakadapidvddvtdpqalkdydllflgaptwntga
dtersgtswdeflydklpevdmkdlpvaifglgdaegypdnfcdaieeihdcfakqgakp
vgfsnpddydyeesksvrdgkflglpldmvndqipmekrvagwveavvsetgv

SCOPe Domain Coordinates for d2fcra_:

Click to download the PDB-style file with coordinates for d2fcra_.
(The format of our PDB-style files is described here.)

Timeline for d2fcra_: