| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
| Protein Flavodoxin [52220] (9 species) |
| Species Chondrus crispus [TaxId:2769] [52221] (1 PDB entry) |
| Domain d2fcra_: 2fcr A: [31151] complexed with fmn |
PDB Entry: 2fcr (more details), 1.8 Å
SCOPe Domain Sequences for d2fcra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]}
kigiffststgnttevadfigktlgakadapidvddvtdpqalkdydllflgaptwntga
dtersgtswdeflydklpevdmkdlpvaifglgdaegypdnfcdaieeihdcfakqgakp
vgfsnpddydyeesksvrdgkflglpldmvndqipmekrvagwveavvsetgv
Timeline for d2fcra_: