SCOPe 2.08: Domain d2fcra_: 2fcr A:

Lineage for d2fcra_ (2fcr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (11 species)

7. Species Chondrus crispus [TaxId:2769] [52221] (1 PDB entry)

8. Domain d2fcra_: 2fcr A: [31151]
   complexed with fmn

Details for d2fcra_

PDB Entry: 2fcr, 1.8 Å

PDB Description: crystal structure of oxidized flavodoxin from a red alga chondrus crispus refined at 1.8 angstroms resolution: description of the flavin mononucleotide binding site

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2fcra_:

Sequence; same for both SEQRES and ATOM records:

>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]}
kigiffststgnttevadfigktlgakadapidvddvtdpqalkdydllflgaptwntga
dtersgtswdeflydklpevdmkdlpvaifglgdaegypdnfcdaieeihdcfakqgakp
vgfsnpddydyeesksvrdgkflglpldmvndqipmekrvagwveavvsetgv

Timeline for d2fcra_:

• d2fcra_ first appeared (with stable ids) in SCOP 1.55, called d2fcr__
  
• d2fcra_ appears in SCOPe 2.07