PDB entry 2fcr

View 2fcr on RCSB PDB site
Description: crystal structure of oxidized flavodoxin from a red alga chondrus crispus refined at 1.8 angstroms resolution: description of the flavin mononucleotide binding site
Class: electron transport
Keywords: electron transport
Deposited on 1992-02-03, released 1992-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Chondrus crispus [TaxId:2769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fcra_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fcrA (A:)
    kigiffststgnttevadfigktlgakadapidvddvtdpqalkdydllflgaptwntga
    dtersgtswdeflydklpevdmkdlpvaifglgdaegypdnfcdaieeihdcfakqgakp
    vgfsnpddydyeesksvrdgkflglpldmvndqipmekrvagwveavvsetgv