SCOPe 2.08: Domain d2scud2: 2scu D:122-286

Lineage for d2scud2 (2scu D:122-286)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)

7. Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)

8. Domain d2scud2: 2scu D:122-286 [31132]
   Other proteins in same PDB: d2scua1, d2scub1, d2scub2, d2scud1, d2scue1, d2scue2
   complexed with coa, so4

Details for d2scud2

PDB Entry: 2scu, 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli

PDB Compounds: (D:) protein (succinyl-coa ligase)

SCOPe Domain Sequences for d2scud2:

Sequence; same for both SEQRES and ATOM records:

>d2scud2 c.23.4.1 (D:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv

Timeline for d2scud2:

• d2scud2 first appeared (with stable ids) in SCOP 1.55
  
• d2scud2 appears in SCOPe 2.07