| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
| Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) automatically mapped to Pfam PF13549 automatically mapped to Pfam PF08442 |
| Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species) |
| Species Escherichia coli [TaxId:562] [56083] (11 PDB entries) |
| Domain d2scub2: 2scu B:1-238 [41562] Other proteins in same PDB: d2scua1, d2scua2, d2scub1, d2scud1, d2scud2, d2scue1 complexed with coa, so4 |
PDB Entry: 2scu (more details), 2.3 Å
SCOPe Domain Sequences for d2scub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2scub2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe
Timeline for d2scub2: