SCOPe 2.07: Domain d1dcfa_: 1dcf A:

Lineage for d1dcfa_ (1dcf A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.2: Receiver domain of the ethylene receptor [52194] (1 protein)
   automatically mapped to Pfam PF00072

6. Protein Receiver domain of the ethylene receptor [52195] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52196] (1 PDB entry)

8. Domain d1dcfa_: 1dcf A: [31124]

Details for d1dcfa_

PDB Entry: 1dcf, 2.5 Å

PDB Description: crystal structure of the receiver domain of the ethylene receptor of arabidopsis thaliana

PDB Compounds: (A:) etr1 protein

SCOPe Domain Sequences for d1dcfa_:

Sequence, based on SEQRES records:

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
pgvenyqialrihekftkqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnir
dvlsdlleprvlye

Sequence, based on observed residues (ATOM records):

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
pgvenyqialrihekftqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnird
vlsdlleprvlye

Timeline for d1dcfa_:

• d1dcfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dcfa_ appears in SCOPe 2.06
  
• d1dcfa_ appears in the current release, SCOPe 2.08