Lineage for d1dcfa_ (1dcf A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21774Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 21882Family c.23.1.2: Receiver domain of the ethylene receptor [52194] (1 protein)
  6. 21883Protein Receiver domain of the ethylene receptor [52195] (1 species)
  7. 21884Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52196] (1 PDB entry)
  8. 21885Domain d1dcfa_: 1dcf A: [31124]

Details for d1dcfa_

PDB Entry: 1dcf (more details), 2.5 Å

PDB Description: crystal structure of the receiver domain of the ethylene receptor of arabidopsis thaliana

SCOP Domain Sequences for d1dcfa_:

Sequence, based on SEQRES records: (download)

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana)}
hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
pgvenyqialrihekftkqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnir
dvlsdlleprvlye

Sequence, based on observed residues (ATOM records): (download)

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana)}
hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
pgvenyqialrihekftqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnird
vlsdlleprvlye

SCOP Domain Coordinates for d1dcfa_:

Click to download the PDB-style file with coordinates for d1dcfa_.
(The format of our PDB-style files is described here.)

Timeline for d1dcfa_: