SCOPe 2.06: Domain d1a2ob1: 1a2o B:1-140

Lineage for d1a2ob1 (1a2o B:1-140)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Methylesterase CheB, N-terminal domain [52190] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52191] (1 PDB entry)

8. Domain d1a2ob1: 1a2o B:1-140 [31121]
   Other proteins in same PDB: d1a2oa2, d1a2ob2

Details for d1a2ob1

PDB Entry: 1a2o, 2.4 Å

PDB Description: structural basis for methylesterase cheb regulation by a phosphorylation-activated domain

PDB Compounds: (B:) cheb methylesterase

SCOPe Domain Sequences for d1a2ob1:

Sequence; same for both SEQRES and ATOM records:

>d1a2ob1 c.23.1.1 (B:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp
rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays
emiaekvrtaarariaahkp

Timeline for d1a2ob1:

• d1a2ob1 first appeared (with stable ids) in SCOP 1.55
  
• d1a2ob1 appears in SCOPe 2.05
  
• d1a2ob1 appears in SCOPe 2.07
  
• d1a2ob1 appears in the current release, SCOPe 2.08