Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Methylesterase CheB, N-terminal domain [52190] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [52191] (1 PDB entry) |
Domain d1a2ob1: 1a2o B:1-140 [31121] Other proteins in same PDB: d1a2oa2, d1a2ob2 |
PDB Entry: 1a2o (more details), 2.4 Å
SCOPe Domain Sequences for d1a2ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2ob1 c.23.1.1 (B:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays emiaekvrtaarariaahkp
Timeline for d1a2ob1: