SCOP 1.71: Domain d1srrc_: 1srr C:

Lineage for d1srrc_ (1srr C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (5 families)

5. Family c.23.1.1: CheY-related [52173] (18 proteins)

6. Protein Sporulation response regulator Spo0F [52188] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52189] (7 PDB entries)

8. Domain d1srrc_: 1srr C: [31112]
   phosphatase resistant mutant

Details for d1srrc_

PDB Entry: 1srr, 1.9 Å

PDB Description: crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis

SCOP Domain Sequences for d1srrc_:

Sequence; same for both SEQRES and ATOM records:

>d1srrc_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis}
mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
k

Timeline for d1srrc_:

• d1srrc_ first appeared (with stable ids) in SCOP 1.55
  
• d1srrc_ appears in SCOP 1.69
  
• d1srrc_ appears in SCOP 1.73
  
• d1srrc_ appears in the current release, SCOPe 2.08