Lineage for d1srra_ (1srr A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 578576Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 578577Family c.23.1.1: CheY-related [52173] (18 proteins)
  6. 578732Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 578733Species Bacillus subtilis [TaxId:1423] [52189] (7 PDB entries)
  8. 578745Domain d1srra_: 1srr A: [31110]

Details for d1srra_

PDB Entry: 1srr (more details), 1.9 Å

PDB Description: crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis

SCOP Domain Sequences for d1srra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srra_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOP Domain Coordinates for d1srra_:

Click to download the PDB-style file with coordinates for d1srra_.
(The format of our PDB-style files is described here.)

Timeline for d1srra_: