Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Sporulation response regulator Spo0A [52186] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [52187] (2 PDB entries) |
Domain d1dz3a_: 1dz3 A: [31105] C-terminal helix-swapping dimer complexed with so4 |
PDB Entry: 1dz3 (more details), 1.65 Å
SCOPe Domain Sequences for d1dz3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy gkt
Timeline for d1dz3a_: