Lineage for d1dz3a_ (1dz3 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982189Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 982386Protein Sporulation response regulator Spo0A [52186] (1 species)
  7. 982387Species Bacillus stearothermophilus [TaxId:1422] [52187] (2 PDB entries)
  8. 982388Domain d1dz3a_: 1dz3 A: [31105]
    C-terminal helix-swapping dimer
    complexed with so4

Details for d1dz3a_

PDB Entry: 1dz3 (more details), 1.65 Å

PDB Description: domain-swapping in the sporulation response regulator spo0a
PDB Compounds: (A:) stage 0 sporulation protein a

SCOPe Domain Sequences for d1dz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy
gkt

SCOPe Domain Coordinates for d1dz3a_:

Click to download the PDB-style file with coordinates for d1dz3a_.
(The format of our PDB-style files is described here.)

Timeline for d1dz3a_: