| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein Sporulation response regulator Spo0A [52186] (1 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [52187] (2 PDB entries) |
| Domain d1dz3a_: 1dz3 A: [31105] C-terminal helix-swapping dimer complexed with so4 |
PDB Entry: 1dz3 (more details), 1.65 Å
SCOPe Domain Sequences for d1dz3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy
gkt
Timeline for d1dz3a_: