SCOPe 2.07: Domain d1tmya_: 1tmy A:

Lineage for d1tmya_ (1tmy A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [52177] (5 PDB entries)
   Uniprot Q56312

8. Domain d1tmya_: 1tmy A: [31083]

Details for d1tmya_

PDB Entry: 1tmy, 1.9 Å

PDB Description: chey from thermotoga maritima (apo-i)

PDB Compounds: (A:) chey protein

SCOPe Domain Sequences for d1tmya_:

Sequence; same for both SEQRES and ATOM records:

>d1tmya_ c.23.1.1 (A:) CheY protein {Thermotoga maritima [TaxId: 2336]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

Timeline for d1tmya_:

• d1tmya_ first appeared (with stable ids) in SCOP 1.55, called d1tmy__
  
• d1tmya_ appears in SCOPe 2.06
  
• d1tmya_ appears in the current release, SCOPe 2.08