Lineage for d1tmy__ (1tmy -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) 
Species Thermotoga maritima [TaxId:243274] [52177] (4 PDB entries) 
Domain d1tmy__: 1tmy - [31083]
Details for d1tmy__
PDB Entry: 1tmy (more details), 1.9 Å
PDB Description: chey from thermotoga maritima (apo-i)
SCOP Domain Sequences for d1tmy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tmy__ c.23.1.1 (-) CheY protein {Thermotoga maritima}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs
SCOP Domain Coordinates for d1tmy__:
Click to download the PDB-style file with coordinates for d1tmy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tmy__:
- d1tmy__ appears in SCOP 1.57
- d1tmy__ appears in the current release, SCOPe 2.08, called d1tmya_
View in 3D