Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein YFV helicase domain [142330] (1 species) |
Species Yellow fever virus [TaxId:11089] [142331] (2 PDB entries) Uniprot P19901 1669-1842! Uniprot P19901 1843-2107 |
Domain d5ffma1: 5ffm A:187-324 [310540] Other proteins in same PDB: d5ffma3 |
PDB Entry: 5ffm (more details), 2.6 Å
SCOPe Domain Sequences for d5ffma1:
Sequence, based on SEQRES records: (download)
>d5ffma1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} mlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgldvk fhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargwaa hraranesatilmtatpp
>d5ffma1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} mlkkgmttvldfhpgtrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgldvkfht qafsaevidamchatltyrmleptrvvnweviimdeahfldpasiaargwaahraranes atilmtatpp
Timeline for d5ffma1: