SCOPe 2.08: Domain d5ffma1: 5ffm A:187-324

Lineage for d5ffma1 (5ffm A:187-324)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein YFV helicase, N-terminal domain [418964] (1 species)

7. Species Yellow fever virus [TaxId:11089] [419426] (2 PDB entries)
   Uniprot P19901

8. Domain d5ffma1: 5ffm A:187-324 [310540]
   Other proteins in same PDB: d5ffma2, d5ffma3

Details for d5ffma1

PDB Entry: 5ffm, 2.6 Å

PDB Description: yellow fever virus helicase

PDB Compounds: (A:) Serine protease NS3

SCOPe Domain Sequences for d5ffma1:

Sequence, based on SEQRES records:

>d5ffma1 c.37.1.14 (A:187-324) YFV helicase, N-terminal domain {Yellow fever virus [TaxId: 11089]}
mlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgldvk
fhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargwaa
hraranesatilmtatpp

Sequence, based on observed residues (ATOM records):

>d5ffma1 c.37.1.14 (A:187-324) YFV helicase, N-terminal domain {Yellow fever virus [TaxId: 11089]}
mlkkgmttvldfhpgtrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgldvkfht
qafsaevidamchatltyrmleptrvvnweviimdeahfldpasiaargwaahraranes
atilmtatpp

Timeline for d5ffma1:

• d5ffma1 first appeared in SCOPe 2.06
  
• d5ffma1 appears in SCOPe 2.07