SCOPe 2.06: Domain d1udrc_: 1udr C:

Lineage for d1udrc_ (1udr C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d1udrc_: 1udr C: [31043]
   mutant

Details for d1udrc_

PDB Entry: 1udr, 1.9 Å

PDB Description: chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4)

PDB Compounds: (C:) chey protein

SCOPe Domain Sequences for d1udrc_:

Sequence; same for both SEQRES and ATOM records:

>d1udrc_ c.23.1.1 (C:) CheY protein {Escherichia coli [TaxId: 562]}
elkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
glellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnkif
eklgm

Timeline for d1udrc_:

• d1udrc_ first appeared (with stable ids) in SCOP 1.55
  
• d1udrc_ appears in SCOPe 2.05
  
• d1udrc_ appears in SCOPe 2.07
  
• d1udrc_ appears in the current release, SCOPe 2.08