Lineage for d1udrb_ (1udr B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114728Protein CheY protein [52174] (5 species)
  7. 2114729Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 2114747Domain d1udrb_: 1udr B: [31042]
    mutant

Details for d1udrb_

PDB Entry: 1udr (more details), 1.9 Å

PDB Description: chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4)
PDB Compounds: (B:) chey protein

SCOPe Domain Sequences for d1udrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udrb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
elkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
glellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnkif
eklgm

SCOPe Domain Coordinates for d1udrb_:

Click to download the PDB-style file with coordinates for d1udrb_.
(The format of our PDB-style files is described here.)

Timeline for d1udrb_: