SCOPe 2.07: Domain d5dwma1: 5dwm A:1-179

Lineage for d5dwma1 (5dwm A:1-179)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Brucella ovis [TaxId:444178] [278686] (2 PDB entries)

8. Domain d5dwma1: 5dwm A:1-179 [310421]
   Other proteins in same PDB: d5dwma2
   automated match to d5dwnd_
   complexed with edo, gol, imd

Details for d5dwma1

PDB Entry: 5dwm, 1.45 Å

PDB Description: crystal structure of phosphinothricin n-acetyltransferase from brucella ovis

PDB Compounds: (A:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d5dwma1:

Sequence; same for both SEQRES and ATOM records:

>d5dwma1 d.108.1.0 (A:1-179) automated matches {Brucella ovis [TaxId: 444178]}
mpvirdfqpadietitaiytqavltgtgsyeiepptmdemakrfaafadqgfpilvaead
grvlgyayasyfrvrpayrwlaedsiyiapdakgqgigklllreliarisalgfrqllav
igdgehnigsvklheslgfthcgriegsgfkhgrwldtvlmqlplnggrstepgpspls

Timeline for d5dwma1:

• d5dwma1 first appeared in SCOPe 2.06
  
• d5dwma1 appears in the current release, SCOPe 2.08