Lineage for d5dwmd_ (5dwm D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575641Species Brucella ovis [TaxId:444178] [278686] (2 PDB entries)
  8. 2575645Domain d5dwmd_: 5dwm D: [310425]
    Other proteins in same PDB: d5dwma2
    automated match to d5dwnd_
    complexed with edo, gol, imd

Details for d5dwmd_

PDB Entry: 5dwm (more details), 1.45 Å

PDB Description: crystal structure of phosphinothricin n-acetyltransferase from brucella ovis
PDB Compounds: (D:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d5dwmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dwmd_ d.108.1.0 (D:) automated matches {Brucella ovis [TaxId: 444178]}
mpvirdfqpadietitaiytqavltgtgsyeiepptmdemakrfaafadqgfpilvaead
grvlgyayasyfrvrpayrwlaedsiyiapdakgqgigklllreliarisalgfrqllav
igdgehnigsvklheslgfthcgriegsgfkhgrwldtvlmqlplnggrstepgpspls

SCOPe Domain Coordinates for d5dwmd_:

Click to download the PDB-style file with coordinates for d5dwmd_.
(The format of our PDB-style files is described here.)

Timeline for d5dwmd_: