SCOPe 2.06: Domain d5cyma2: 5cym A:430-554

Lineage for d5cyma2 (5cym A:430-554)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (20 PDB entries)

8. Domain d5cyma2: 5cym A:430-554 [310358]
   Other proteins in same PDB: d5cyma1, d5cyma3, d5cymb_
   automated match to d1dloa1
   complexed with dms, edo, iod, pyz, so4, t27

Details for d5cyma2

PDB Entry: 5cym, 2.1 Å

PDB Description: hiv-1 reverse transcriptase complexed with 4-iodopyrazole

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d5cyma2:

Sequence, based on SEQRES records:

>d5cyma2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Sequence, based on observed residues (ATOM records):

>d5cyma2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggndkls
a

Timeline for d5cyma2:

• d5cyma2 is new in SCOPe 2.06-stable
  
• d5cyma2 appears in SCOPe 2.07
  
• d5cyma2 appears in the current release, SCOPe 2.08