Lineage for d5cyma2 (5cym A:430-554)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887354Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries)
  8. 2887357Domain d5cyma2: 5cym A:430-554 [310358]
    Other proteins in same PDB: d5cyma1, d5cyma3, d5cymb_
    automated match to d1dloa1
    complexed with dms, edo, iod, pyz, so4, t27

Details for d5cyma2

PDB Entry: 5cym (more details), 2.1 Å

PDB Description: hiv-1 reverse transcriptase complexed with 4-iodopyrazole
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d5cyma2:

Sequence, based on SEQRES records: (download)

>d5cyma2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Sequence, based on observed residues (ATOM records): (download)

>d5cyma2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggndkls
a

SCOPe Domain Coordinates for d5cyma2:

Click to download the PDB-style file with coordinates for d5cyma2.
(The format of our PDB-style files is described here.)

Timeline for d5cyma2:

View in 3D
Domains from other chains:
(mouse over for more information)
d5cymb_