| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
| Protein automated matches [190396] (40 species) not a true protein |
| Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries) |
| Domain d5cyma2: 5cym A:430-554 [310358] Other proteins in same PDB: d5cyma1, d5cyma3, d5cymb_ automated match to d1dloa1 complexed with dms, edo, iod, pyz, so4, t27 |
PDB Entry: 5cym (more details), 2.1 Å
SCOPe Domain Sequences for d5cyma2:
Sequence, based on SEQRES records: (download)
>d5cyma2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa
>d5cyma2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggndkls
a
Timeline for d5cyma2: