Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins) strand 5 is parallel to strand 4 Pfam PF08210; Pfam PF05240 |
Protein automated matches [310855] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311219] (22 PDB entries) |
Domain d5cqia1: 5cqi A:190-378 [310352] Other proteins in same PDB: d5cqia2 automated match to d4xxoa_ complexed with gol, zn |
PDB Entry: 5cqi (more details), 1.68 Å
SCOPe Domain Sequences for d5cqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cqia1 c.97.1.6 (A:190-378) automated matches {Human (Homo sapiens) [TaxId: 9606]} rylmdpdtftsnfnndplvlrrrqtylcyeverldngtsvkmdqhmgflcnesgrhaelr fldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrikaariydydp lykealqmlrdagaqvsimtydefeycwdtfvyrqgcpfqpwdgleehsqalsgrlrail q
Timeline for d5cqia1: