SCOP 1.61: Domain d1euia_: 1eui A:

Lineage for d1euia_ (1eui A:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Escherichia coli [TaxId:562] [52146] (9 PDB entries)

8. Domain d1euia_: 1eui A: [31028]
   Other proteins in same PDB: d1euic_, d1euid_

Details for d1euia_

PDB Entry: 1eui, 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1euia_:

Sequence; same for both SEQRES and ATOM records:

>d1euia_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
twhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqdp
yhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllntv
ltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlka
phpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

Timeline for d1euia_:

• d1euia_ first appeared (with stable ids) in SCOP 1.55
  
• d1euia_ appears in SCOP 1.59
  
• d1euia_ appears in SCOP 1.63
  
• d1euia_ appears in the current release, SCOPe 2.08