Lineage for d1euic_ (1eui C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190011Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 190250Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
  5. 190251Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 190252Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 190255Species Bacteriophage pbs2 [TaxId:10684] [54445] (6 PDB entries)
  8. 190271Domain d1euic_: 1eui C: [38140]
    Other proteins in same PDB: d1euia_, d1euib_

Details for d1euic_

PDB Entry: 1eui (more details), 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1euic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euic_ d.17.5.1 (C:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
sngenkikml

SCOP Domain Coordinates for d1euic_:

Click to download the PDB-style file with coordinates for d1euic_.
(The format of our PDB-style files is described here.)

Timeline for d1euic_: