SCOP 1.61: Domain d1udh__: 1udh -

Lineage for d1udh__ (1udh -)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries)

8. Domain d1udh__: 1udh - [31015]

Details for d1udh__

PDB Entry: 1udh, 1.75 Å

PDB Description: the structural basis of specific base excision repair by uracil-dna glycosylase

SCOP Domain Sequences for d1udh__:

Sequence; same for both SEQRES and ATOM records:

>d1udh__ c.18.1.1 (-) Uracil-DNA glycosylase {Herpes simplex virus type 1}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

Timeline for d1udh__:

• d1udh__ first appeared (with stable ids) in SCOP 1.55
  
• d1udh__ appears in SCOP 1.59
  
• d1udh__ appears in SCOP 1.63
  
• d1udh__ appears in the current release, SCOPe 2.08, called d1udha_